PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00011447-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 565aa    MW: 63415.4 Da    PI: 4.779
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00011447-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS468.9e-15289346158
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs 58 
                       l+ lL++cA+av+++d+++ +++L++++++as +gd +qRla yf+ +L arl++s+ 
  PSME_00011447-RA 289 LRALLVHCAQAVATDDTRRPNEILKQIRQHASAYGDGTQRLANYFADGLVARLSGSGG 346
                       5789*************************************************99765 PP

2GRAS171.66.2e-53350529155335
              GRAS 155 keeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqead 247
                       +e++eetg+rLa++A+++gvpfe+++ +a ++e+l++eeL+++++E+l+Vn++++  +llde+v  es+++ vL+ ++s++P+v+++   +  
  PSME_00011447-RA 350 AERIEETGRRLADYAKSFGVPFEYHA-IAAKWENLDVEELSLRSDEVLVVNCMYRFNNLLDETVIPESPKNIVLNKIRSMNPRVFIHGVVNGA 441
                       6899**********************.799*************************************************************** PP

              GRAS 248 hnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                       +n++ F + f eal +ysalfd++e+ +pre+ +r  +E+el+grei nvvaceg er+ r et+++W+ ++++aGF ++pl+  + +
  PSME_00011447-RA 442 YNAPLFITWFREALFHYSALFDAIETIVPREHPQRLLLEKELFGREILNVVACEGLERVVRPETYKQWQVMIQRAGFVQLPLDRAIFS 529
                       *********************************************************************************9987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035143.1E-12289346IPR005202Transcription factor GRAS
PROSITE profilePS5098528.298327548IPR005202Transcription factor GRAS
PfamPF035142.2E-50350529IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MLMDENMDEK KCMYQECSAL QATVKPFYDI LGENYPPQGL CNSNTVGENQ KQSFNYYEDD  60
VQNKIEDSSW IGDFFNSQMP GGFESPLSPN LSAGYSSQYS FSYSVSSTVT DGLPGSPTYE  120
PSLSESKQGL EAGEFDEDIQ VVPKQNFEPG VENGCHFRAP KKVSDRGPDL QLGKREDAIF  180
GVGVTFQMNA VHSEDENGPK REKDPHRGDL DLEDRDSNKL SAVYPDNVIR NESFDKVLLC  240
IENSRVFLDV QLEILQNGVQ KSVRSGFVKG LQGSKARGRK QGKRAVVDLR ALLVHCAQAV  300
ATDDTRRPNE ILKQIRQHAS AYGDGTQRLA NYFADGLVAR LSGSGGRLAA ERIEETGRRL  360
ADYAKSFGVP FEYHAIAAKW ENLDVEELSL RSDEVLVVNC MYRFNNLLDE TVIPESPKNI  420
VLNKIRSMNP RVFIHGVVNG AYNAPLFITW FREALFHYSA LFDAIETIVP REHPQRLLLE  480
KELFGREILN VVACEGLERV VRPETYKQWQ VMIQRAGFVQ LPLDRAIFSE TMDKDPDCPG  540
FSLPFLEPVS VSLLSLVDPP LWVGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-15350523157328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA3E2G21e-155A3E2G2_PINRA; SCARECROW-like protein 1
STRINGGSMUA_Achr6P34090_0011e-112(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.15e-72GRAS family protein